PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013592376.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family EIL
Protein Properties Length: 571aa    MW: 64370.6 Da    PI: 5.0519
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013592376.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN34341.4e-132273511324
                     XXXXXXXXXXXXXXXXXXXXXXX..XXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
            EIN3   1 eelkkrmwkdqmllkrlkerkkqlledkeaatgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgkpvegasdsLraWW 95 
                     e+l++rmwkd+++lkr+ker+k     + +   ++  +k+++qa+rkkmsraQDgiLkYMlk mevc+++GfvYgiipekgkpv+g+sd++raWW
  XP_013592376.1  27 EDLERRMWKDRVRLKRIKERQKGDS--QGP-QAKEPPKKISDQAQRKKMSRAQDGILKYMLKLMEVCKVRGFVYGIIPEKGKPVSGSSDNIRAWW 118
                     89********************965..555.4456689********************************************************* PP

                     XXXXXXXXXXXXXXXXXXXXXXXXXXXXXX....XX----STTS-HHHHHHHHHHHSSSSSS-TTS--TTT--HHHH---S--HHHHHHT--TT- CS
            EIN3  96 kekvefdrngpaaiskyqaknlilsgesslqtersseshslselqDTtlgSLLsalmqhcdppqrrfplekgvepPWWPtGkelwwgelglskdq 190
                     kekv+fd+ngpaai+ky+ ++l++++++++    ++++  l++lqD+tlgSLLs+lmqhcdppqr++plekg++pPWWPtGke+ww +lgl+++q
  XP_013592376.1 119 KEKVKFDKNGPAAIAKYEEECLAFGKSDGN----RNSQFVLQDLQDATLGSLLSSLMQHCDPPQRKYPLEKGTPPPWWPTGKEEWWVKLGLPQSQ 209
                     ************************987777....77999******************************************************** PP

                     -.-----GGG--HHHHHHHHHHHHHHTGGGHHHHHHTTTTSSSSTTT--SHHHHHHHHHHTTTTT-S--XXXX...XX.....XXXX....XXXX CS
            EIN3 191 gtppykkphdlkkawkvsvLtavikhmsptieeirelerqskylqdkmsakesfallsvlnqeekecatvsah...ss.....slrk....qspk 273
                     + ppy+kphdlkk+wkv+vLtavi+hmsp+i++i++++rqsk+lqdkm+akes+++l+vlnqee+++++ s++   s+        +    +++k
  XP_013592376.1 210 S-PPYRKPHDLKKMWKVGVLTAVINHMSPDIAKIKRHVRQSKCLQDKMTAKESAIWLAVLNQEESLIQQPSSDngtSNvtethR--RgnnaDRRK 301
                     9.9**********************************************************************65422787540..334458889 PP

                     XXXXXXXXXXXXXXXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX. CS
            EIN3 274 vtlsceqkedvegkkeskikhvqavkttagfpvvrkrkkkpsesakvsske 324
                     +++++++++dv+g++e + + ++++++++++p++  ++ + +++ k+ +++
  XP_013592376.1 302 TVINSDSDYDVDGTEEASGSVSSKDSRRNQVPAATSQQ-PVRDQDKAGKHK 351
                     99**********99999999999999999555555544.333333333332 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048739.9E-12627272No hitNo description
Gene3DG3DSA:1.10.3180.103.6E-71148280IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
SuperFamilySSF1167688.11E-61153275IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042762Biological Processregulation of sulfur metabolic process
GO:0071281Biological Processcellular response to iron ion
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 571 aa     Download sequence    Send to blast
MENEQPDDLA SDTVAEIDVS DEEIDAEDLE RRMWKDRVRL KRIKERQKGD SQGPQAKEPP  60
KKISDQAQRK KMSRAQDGIL KYMLKLMEVC KVRGFVYGII PEKGKPVSGS SDNIRAWWKE  120
KVKFDKNGPA AIAKYEEECL AFGKSDGNRN SQFVLQDLQD ATLGSLLSSL MQHCDPPQRK  180
YPLEKGTPPP WWPTGKEEWW VKLGLPQSQS PPYRKPHDLK KMWKVGVLTA VINHMSPDIA  240
KIKRHVRQSK CLQDKMTAKE SAIWLAVLNQ EESLIQQPSS DNGTSNVTET HRRGNNADRR  300
KTVINSDSDY DVDGTEEASG SVSSKDSRRN QVPAATSQQP VRDQDKAGKH KRRKRPRIRS  360
GTLNVQDEEQ VEAEGRNVLP DMNHVEAPML DYNINGTTNH HEEGVLEPNI SLGPEENGLE  420
LVVPEFDSNY TYLPPVDGQA MMPVDERPML YGANPNQELQ FGSGYNYYNT SAVFVHNQEE  480
DLIHTQIEMN SQAPPHSNGF DGQGGVLQPH GNEEVGVAGR DMPPQFQSDQ DKLLDSNILS  540
PFNDLPFDSS TFYSGFDSFG AFDDDYSWFG A
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wij_A8e-851522839140ETHYLENE-INSENSITIVE3-like 3 protein
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00233DAPTransfer from AT1G73730Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013592375.10.0PREDICTED: ETHYLENE INSENSITIVE 3-like 3 protein isoform X1
RefseqXP_013592376.10.0PREDICTED: ETHYLENE INSENSITIVE 3-like 3 protein isoform X2
SwissprotO231160.0EIL3_ARATH; ETHYLENE INSENSITIVE 3-like 3 protein
TrEMBLA0A078C9Z10.0A0A078C9Z1_BRANA; BnaC06g34570D protein
TrEMBLA0A0D3D0F80.0A0A0D3D0F8_BRAOL; Uncharacterized protein
STRINGBra015970.1-P0.0(Brassica rapa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73730.10.0ETHYLENE-INSENSITIVE3-like 3